PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10010143m
Common NameCARUB_v10010143mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 242aa    MW: 27737.1 Da    PI: 8.6131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10010143mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-173380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed +l+ ++ ++G g+W++ ++  g++Rt+k+c++rw++yl
  Carubv10010143m 33 RGPWTVDEDTKLITYISLHGEGRWNSLSHSAGLNRTGKSCRLRWLNYL 80
                     89********************************************97 PP

2Myb_DNA-binding45.61.6e-1486129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg  + eE+ ++++++ ++G++ W++Ia+ ++ gRt++++k++w++
  Carubv10010143m  86 RGDISLEEQFIILELHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 129
                      567789****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-212783IPR009057Homeodomain-like
PROSITE profilePS5129422.8542884IPR017930Myb domain
SuperFamilySSF466891.01E-2931127IPR009057Homeodomain-like
SMARTSM007176.8E-153282IPR001005SANT/Myb domain
PfamPF002492.7E-163380IPR001005SANT/Myb domain
CDDcd001674.70E-103580No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2284133IPR009057Homeodomain-like
PROSITE profilePS5129416.43185135IPR017930Myb domain
SMARTSM007171.3E-1285133IPR001005SANT/Myb domain
PfamPF002493.4E-1386129IPR001005SANT/Myb domain
CDDcd001671.01E-890129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MNICRTESTN CKTLKQKEEV EEVKKKTETE IRRGPWTVDE DTKLITYISL HGEGRWNSLS  60
HSAGLNRTGK SCRLRWLNYL RPDIRRGDIS LEEQFIILEL HSRWGNRWSK IAQQLPGRTD  120
NEIKNYWRTR VQKHAKLLKC DVNSKQFKDL IKHYWMPRLV ERIATAQVVE SVPNHHSGAA  180
TAGAASSTSS SESSVRSSFY GGDQVEYGTL DHMTNGSDWF NGGDALETLW SVDELNNWLL  240
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-253013324126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305561.11e-180hypothetical protein CARUB_v10010143mg
SwissprotQ9LDE11e-72MY108_ARATH; Transcription factor MYB108
TrEMBLR0I7Z81e-180R0I7Z8_9BRAS; Uncharacterized protein
STRINGAT1G48000.11e-126(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-119myb domain protein 112